MYCBPAP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MYCBPAP Antibody [NBP2-14790] - Staining of human cell line SH-SY5Y shows localization to vesicles.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MYCBPAP Antibody [NBP2-14790] - Staining in human testis and prostate tissues using anti-MYCBPAP antibody. Corresponding MYCBPAP RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: MYCBPAP Antibody [NBP2-14790] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MYCBPAP Antibody [NBP2-14790] - Staining of human prostate shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MYCBPAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LLPRFRSPISETQVPRPENEALRESGSQKARVGTKSPQRKSIMEEILVEESPDVDSTKSPWEPDGLPLLEWNLCLEDFRKAVMVLPDENHREDALMRLNKAALELCQKPRPLQSNLLHQM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYCBPAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MYCBPAP Protein (NBP2-14790PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYCBPAP Antibody

  • AMAP1
  • AMAP-1
  • MYCBPAP MYCBP associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-81958
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP3-16813
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00026292-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-24459
Species: Ca, Ch, Hu, Mu, Pm, Rb, Rt, RM, Xp, Ze
Applications: ICC/IF, WB
NBP1-85614
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
236-EG
Species: Hu
Applications: BA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00000277-T01
Species: Hu
Applications: WB
NBP2-61862
Species: Hu, Rt
Applications: ELISA, Flow, WB
NBP1-89172
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DY8198-05
Species: Hu
Applications: ELISA

Publications for MYCBPAP Antibody (NBP2-14790) (0)

There are no publications for MYCBPAP Antibody (NBP2-14790).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYCBPAP Antibody (NBP2-14790) (0)

There are no reviews for MYCBPAP Antibody (NBP2-14790). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MYCBPAP Antibody (NBP2-14790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYCBPAP Products

Diseases for MYCBPAP Antibody (NBP2-14790)

Discover more about diseases related to MYCBPAP Antibody (NBP2-14790).
 

Pathways for MYCBPAP Antibody (NBP2-14790)

View related products by pathway.

Blogs on MYCBPAP

There are no specific blogs for MYCBPAP, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYCBPAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYCBPAP