MYBPC2 Antibody

Images

 
Western Blot: MYBPC2 Antibody [NBP1-70646] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYBPC2 Antibody Summary

Immunogen
Synthetic peptides corresponding to MYBPC2(myosin binding protein C, fast type) The peptide sequence was selected from the N terminal of MYBPC2. Peptide sequence KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYBPC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MYBPC2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MYBPC2 Antibody

  • C-protein, skeletal muscle fast isoform
  • fast MyBP-C
  • fast-type muscle myosin-binding-protein C
  • MGC163408
  • MYBPC
  • MYBPCF
  • myosin binding protein C, fast type
  • myosin-binding protein C, fast-type

Background

The function of MYBPC2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
AF7439
Species: Hu
Applications: WB, IHC
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24490
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-45839
Species: Hu
Applications: WB, IHC, IF
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-47836
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-86279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF

Publications for MYBPC2 Antibody (NBP1-70646) (0)

There are no publications for MYBPC2 Antibody (NBP1-70646).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYBPC2 Antibody (NBP1-70646) (0)

There are no reviews for MYBPC2 Antibody (NBP1-70646). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYBPC2 Antibody (NBP1-70646) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYBPC2 Products

Bioinformatics Tool for MYBPC2 Antibody (NBP1-70646)

Discover related pathways, diseases and genes to MYBPC2 Antibody (NBP1-70646). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYBPC2 Antibody (NBP1-70646)

Discover more about diseases related to MYBPC2 Antibody (NBP1-70646).
 

Pathways for MYBPC2 Antibody (NBP1-70646)

View related products by pathway.

PTMs for MYBPC2 Antibody (NBP1-70646)

Learn more about PTMs related to MYBPC2 Antibody (NBP1-70646).

Blogs on MYBPC2

There are no specific blogs for MYBPC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYBPC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYBPC2