Recombinant Human MURF3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MURF3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 186-254 of Human MURF3

Source: Wheat Germ

Amino Acid Sequence: PILASQNTKIIDSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIM54
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
33.33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MURF3 Protein

  • MuRF
  • muRF3
  • MURF-3
  • MURFtripartite motif-containing protein 54
  • Muscle-specific RING finger protein 3
  • Muscle-specific RING finger protein
  • RING finger protein 30muscle-specific RING-finger protein 3
  • RNF30
  • tripartite motif containing 54
  • tripartite motif-containing 54

Background

TRIM54 - tripartite motif-containing 54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5366
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-33691
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86609
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF619
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00057159-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MURF3 Partial Recombinant Protein (H00057159-Q01) (0)

There are no publications for MURF3 Partial Recombinant Protein (H00057159-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MURF3 Partial Recombinant Protein (H00057159-Q01) (0)

There are no reviews for MURF3 Partial Recombinant Protein (H00057159-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MURF3 Partial Recombinant Protein (H00057159-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MURF3 Partial Recombinant Protein (H00057159-Q01)

Discover related pathways, diseases and genes to MURF3 Partial Recombinant Protein (H00057159-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MURF3 Partial Recombinant Protein (H00057159-Q01)

Discover more about diseases related to MURF3 Partial Recombinant Protein (H00057159-Q01).
 

Pathways for MURF3 Partial Recombinant Protein (H00057159-Q01)

View related products by pathway.

PTMs for MURF3 Partial Recombinant Protein (H00057159-Q01)

Learn more about PTMs related to MURF3 Partial Recombinant Protein (H00057159-Q01).
 

Research Areas for MURF3 Partial Recombinant Protein (H00057159-Q01)

Find related products by research area.

Blogs on MURF3

There are no specific blogs for MURF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LC3A Antibody
NB100-2331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MURF3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM54