Home » MuRF1/TRIM63 » MuRF1/TRIM63 Proteins » Recombinant Human MuRF1/TRIM63 Protein

Recombinant Human MuRF1/TRIM63 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human MuRF1/TRIM63 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 254-352 of Human MuRF1/TRIM63

Source: Wheat Germ

Amino Acid Sequence: DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIM63
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MuRF1/TRIM63 Protein

  • EC 6.3.2.-
  • IRF
  • IRFMURF2
  • Iris RING finger protein
  • MuRF1
  • MuRF-1
  • muscle specific ring finger protein 2
  • Muscle-specific RING finger protein 1
  • RING finger protein 28FLJ32380
  • RNF28
  • RNF28E3 ubiquitin-protein ligase TRIM63
  • SMRZ
  • SMRZMURF-1
  • Striated muscle RING zinc finger protein
  • TRIM63
  • tripartite motif containing 63
  • tripartite motif-containing 63
  • Tripartite motif-containing protein 63

Background

TRIM63 - tripartite motif-containing 63

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Fbx32 Antibody
NBP1-97856
Western Blot: Fbx32 Antibody [NBP1-97856] - Western blot analysis was performed on mouse skeletal muscle proteins separated by 4-12% SDS-PAGE and transferred on nitrocellulose membrane, blocked with 5% non-fat milk and probed with anti Fbx32 1:500 in non-fat milk. This image was submitted via customer Review.
Western Blot: Fbx32 Antibody [NBP1-97856]
(1 Review)
Species: Hu, Mu, Rt
Applications: WB
IRF1 Antibody
AF4715
Western blot shows lysates of NIH-3T3 mouse embryonic fibroblast cell line. Gels were loaded with 30 μg of whole cell lysate (WCL), 20 μg of cytoplasmic (Cyto), and 10 μg of nuclear extracts (Nuc). PVDF membrane was probed with 1 µg/mL Mouse IRF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4715) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for IRF1 was detected at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(492 Publications)
Species: Hu
IRF7 Antibody
NBP1-77263
Western Blot: IRF7 Antibody [NBP1-77263] - 293 whole cell lysate with IRF7 antibody at (A) 0.5 and (B) 1 ug/ml and (C) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: IRF7 Antibody [NBP1-77263] - Mouse Spleen cells using IRF7 antibody at 20 ug/ml.
Immunohistochemistry-Paraffin: IRF7 Antibody [NBP1-77263] - IRF7 in human spleen tissue with at 5 ug/mL.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
IRF2 Antibody
[Unconjugated]
AF4049
Western blot shows nuclear extracts of LNCaP human prostate cancer cell line, U937 human histiocytic lymphoma cell line, and HeLa human cervical epithelial carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human IRF2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4049) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for IRF2 at approximately 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of U937 human histiocytic lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for IRF2 at approximately 61 kDa (as indicated) using 5 µg/mL of Goat Anti-Human IRF2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4049) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Hu
Applications: WB, Simple Western
IRF3 Antibody
(OTI2G3)
NBP1-47812
Western Blot: IRF3 Antibody (2G3) [NBP1-47812] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY IRF3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-IRF3.
Immunocytochemistry/Immunofluorescence: IRF3 Antibody (2G3) [NBP1-47812] Staining of COS7 cells transiently transfected by pCMV6-ENTRY IRF3.
Immunohistochemistry-Paraffin: IRF3 Antibody (2G3) [NBP1-47812] - Staining of paraffin-embedded pancreas tissue using anti-IRF3 mouse monoclonal antibody.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NFkB p50 (NLS)
Inhibitor Peptide Set
NBP2-29323
Functional (Inhibition): NFkB p105/p50 Inhibitor Peptide Set [NBP2-29323] - TLR5/NF-kB/SEAPorter HEK 293 (NBP2-26277) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated with different concentrations (0, 1, 5, 10, 25 and 50 uM) of Inhibitory Peptide (NBP2-29323) and Control Peptide (NBP2-29334) for 1 h. Cells were then stimulated with 1 ng/ml Flagellin (NBP2-25289) for 24 h. Secreted alkaline phosphatase (SEAP) was analyzed using SEAPorter Assay Kit (NBP2-25285). *p < 0.05 versus control peptide at the corresponding concentrations (Mann-Whitney U test).
(10 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Paraffin-embedded Gastric CA.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ILT6/CD85e/LILRA3
Antibody [Unconjugate ...
AF2574
Human peripheral blood monoctyes were stained with Mouse Anti-Human CD14 APC‑conjugated Monoclonal Antibody (Catalog # FAB3832A) and either (A) Goat Anti-Human LILRA3/CD85e Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2574) or (B) Normal Goat IgG Control(Catalog # AB-108-C) followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Species: Hu
Applications: CyTOF-ready, ICFlow
Recombinant Human
Interferon alpha Prot ...
NBP2-26551
Recombinant Human Interferon alpha Protein
(1 Publication)
Species: Hu
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
IRF8 Antibody
NBP1-83123
Western Blot: IRF8 Antibody [NBP1-83123] - Analysis in human cell line THP-1.
Immunocytochemistry/Immunofluorescence: IRF8 Antibody [NBP1-83123] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: IRF8 Antibody [NBP1-83123] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
IGF-I
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(2 Reviews)
(98 Publications)
Species: Hu
IFN-gamma
[Unconjugated]
285-IF
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.15‑0.75 ng/mL.
(5 Reviews)
(244 Publications)
Species: Hu
TOR/mTOR Antibody
NB100-240
Western Blot: TOR/mTOR Antibody [NB100-240] - Detection of Human mTOR by Western Blot. Samples: Whole cell lysate (50, 15, 5 ug) from HeLa, and (50 ug) 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-mTOR antibody NB100-240 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: TOR/mTOR Antibody [NB100-240] - Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 ug) cells. Affinity purified rabbit anti-mTOR antibody used for WB at 0.4 ug/ml (A) used for IP at 3 ug/mg lysate. mTOR was also immunoprecipitated by a previous lot of this antibody and by rabbit anti-mTOR antibodies NB100-241 and NB100-58821. For blotting immunoprecipitated mTOR, NB100-58821 was used at 1 ug/ml. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 3 minutes (B).
Proximity Ligation Assay: TOR/mTOR Antibody [NB100-240] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human RPL26 (NBP2-22233) and rabbit anti-human mTOR (NB100-240). Image merged from DAPI (2ms) and Texas Red (100ms) exposures, 40X magnification.
(5 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
TLR4 Antibody
(76B357.1)
NB100-56566
Western Blot: TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using 2 ug/ml on (A) human intestine and 6 ug/ml on (B) mouse intestine and C) rat intestine lysate.
Immunohistochemistry-Paraffin: TLR4 Antibody (76B357.1) [NB100-56566] - Formalin-fixed, paraffin-embedded human skin stained with at 5 ug/ml, peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow (Intracellular): TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using PE conjugate of NBP2-27149. An intracellular stain was performed on Jurkat cells with TLR4 antibody (76B357.1) NBP2-27149PE (blue) and an isotype control MAB004 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
(5 Reviews)
(69 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Recombinant Human
MuRF1/TRIM63 Protein
H00084676-Q01
Recombinant Human MuRF1/TRIM63 Protein
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01) (0)

There are no publications for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01) (0)

There are no reviews for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MuRF1/TRIM63 Products

Bioinformatics Tool for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01)

Discover related pathways, diseases and genes to MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01)

Discover more about diseases related to MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01).
 

Pathways for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01)

View related products by pathway.

PTMs for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01)

Learn more about PTMs related to MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01).
 

Research Areas for MuRF1/TRIM63 Partial Recombinant Protein (H00084676-Q01)

Find related products by research area.

Blogs on MuRF1/TRIM63

There are no specific blogs for MuRF1/TRIM63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human MuRF1/TRIM63 Protein
H00084676-P01-10ug
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: MuRF1/TRIM63 Antibody [NBP1-31207] - Mouse skeletal muscle proteins were separated by 4-12% SDS-PAGE. This image was submitted via customer Review.
MuRF1/TRIM63 Antibody
NBP1-31207
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MuRF1/TRIM63 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM63
Entrez