MTRR Antibody - BSA Free

Western Blot: MTRR Antibody [NBP2-87858] - Host: Rabbit. Target Name: MTRR. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Immunohistochemistry-Paraffin: MTRR Antibody [NBP2-87858] - Formalin Fixed Paraffin Embedded Tissue: Human Adult liver. Observed Staining: Membrane. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3.

Western Blot: MTRR Antibody [NBP2-87858] - WB Suggested Anti-MTRR antibody Titration: 1 ug/mL. Sample Type: Human liver

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MTRR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MTRR Antibody - BSA Free (NBP2-87858) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MTRR. Peptide sequence: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTRR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MTRR Antibody - BSA Free

• [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing)
• 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
• cblE
• EC 1.16.1.8
• methionine synthase reductase
• methionine synthase reductase, mitochondrial
• MGC129643
• MSR

Background

MTRR, also known as Methionine synthase reductase, consists of 3 isoforms, a 725 amino acid isoform 1 that is 80 kDa, a 658 amino acid isoform 2 that is 78 kDa and 58 amino acid isoform 2 that is 6 kDa, cytoplasm located, found in all tissues tested, particularly abundant in skeletal muscle, regenerates a functional methionine synthase via reductive methylation, and it is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Current research is being performed onseveral diseases and disorders including homocystinuria-megaloblastic anemia cbl e type, neural tube defects folate-sensitive, homocystinuria-megaloblastic anemia, neural tube defect, cble, disorders of intracellular cobalamin metabolism, megaloblastic anemia, homocysteine, diffuse large b-cell lymphoma, homocysteine plasma level, cleft lip/palate, age related macular degeneration, deep vein thrombosis, homocystinuria, patent ductus arteriosus, spina bifida, b-cell lymphomas, methylcobalamin deficiency, abdominal aortic aneurysm, hyperhomocysteinemia, and Down syndrome. The protein has been linked to the Antimetabolite Pathway - Folate Cycle, Pharmacodynamics, Methotrexate Pathway (Cancer Cell) Pharmacodynamics, Thiopurine Pathway Pharmacokinetics/Pharmacodynamics, One Carbon Metabolism, Folate Metabolism, Sulfur amino acid metabolism, Biological oxidations, Metabolism of amino acids and derivatives, and Phase II conjugation pathways where it interacts with MMAB, ELAVL1, and UBC proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTRR