MTRR Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human MTRR. Peptide sequence: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MTRR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for MTRR Antibody - BSA Free
Background
MTRR, also known as Methionine synthase reductase, consists of 3 isoforms, a 725 amino acid isoform 1 that is 80 kDa, a 658 amino acid isoform 2 that is 78 kDa and 58 amino acid isoform 2 that is 6 kDa, cytoplasm located, found in all tissues tested, particularly abundant in skeletal muscle, regenerates a functional methionine synthase via reductive methylation, and it is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Current research is being performed onseveral diseases and disorders including homocystinuria-megaloblastic anemia cbl e type, neural tube defects folate-sensitive, homocystinuria-megaloblastic anemia, neural tube defect, cble, disorders of intracellular cobalamin metabolism, megaloblastic anemia, homocysteine, diffuse large b-cell lymphoma, homocysteine plasma level, cleft lip/palate, age related macular degeneration, deep vein thrombosis, homocystinuria, patent ductus arteriosus, spina bifida, b-cell lymphomas, methylcobalamin deficiency, abdominal aortic aneurysm, hyperhomocysteinemia, and Down syndrome. The protein has been linked to the Antimetabolite Pathway - Folate Cycle, Pharmacodynamics, Methotrexate Pathway (Cancer Cell) Pharmacodynamics, Thiopurine Pathway Pharmacokinetics/Pharmacodynamics, One Carbon Metabolism, Folate Metabolism, Sulfur amino acid metabolism, Biological oxidations, Metabolism of amino acids and derivatives, and Phase II conjugation pathways where it interacts with MMAB, ELAVL1, and UBC proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Publications for MTRR Antibody (NBP2-87858) (0)
There are no publications for MTRR Antibody (NBP2-87858).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MTRR Antibody (NBP2-87858) (0)
There are no reviews for MTRR Antibody (NBP2-87858).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MTRR Antibody (NBP2-87858) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MTRR Products
Research Areas for MTRR Antibody (NBP2-87858)
Find related products by research area.
|
Blogs on MTRR