MTMR3 Antibody (1E11)

Western Blot: MTMR3 Antibody (1E11) [H00008897-M07] - Western Blot analysis of MTMR3 expression in transfected 293T cell line by MTMR3 monoclonal antibody (M07), clone 1E11. Lane 1: MTMR3 transfected lysate (133.6 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: MTMR3 Antibody (1E11) [H00008897-M07] - Analysis of monoclonal antibody to MTMR3 on HeLa cell. Antibody concentration 15 ug/ml

ELISA: MTMR3 Antibody (1E11.) [H00008897-M07] - MTMR3 Antibody (1E11) [H00008897-M07] - Detection limit for recombinant GST tagged MTMR3 is 0.1 ng/ml as a capture antibody.

Product Discontinued

MTMR3 Antibody (1E11) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MTMR3 (NP_066576.1, 579 a.a. ~ 674 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG
• Specificity: MTMR3 - myotubularin related protein 3 (1E11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MTMR3
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTMR3 Antibody (1E11)

• FLJ32333
• FYVE-DSP1FYVE domain containing 10
• myotubularin related protein 3

Background

This gene encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3,5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTMR3