MTF1 Antibody (2E5)

Images

 
ELISA: MTF1 Antibody (2E5) [H00004520-M01] - MTF1 Antibody (2E5) [H00004520-M01] - Detection limit for recombinant GST tagged MTF1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, Func, S-ELISA
Clone
2E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MTF1 Antibody (2E5) Summary

Immunogen
MTF1 (NP_005946, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY
Specificity
MTF1 - metal-regulatory transcription factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Functional
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00004520-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTF1 Antibody (2E5)

  • metal regulatory transcription factor 1
  • metal-regulatory transcription factor 1
  • metal-responsive transcription factor 1
  • MGC23036
  • MRE-binding transcription factor
  • MRE-binding transcription factor-1
  • MTF-1
  • Transcription factor MTF-1
  • zinc regulatory factor
  • ZRF

Background

This gene encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-94196
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP1-97493
Species: Hu, Mu, Rt, Eq, Fi, Rb
Applications: WB, EIA, IHC, IHC-P
H00004520-M01
Species: Hu, Rt
Applications: WB, ELISA, Func, S-ELISA

Publications for MTF1 Antibody (H00004520-M01)(1)

Reviews for MTF1 Antibody (H00004520-M01) (0)

There are no reviews for MTF1 Antibody (H00004520-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTF1 Antibody (H00004520-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MTF1 Products

Bioinformatics Tool for MTF1 Antibody (H00004520-M01)

Discover related pathways, diseases and genes to MTF1 Antibody (H00004520-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTF1 Antibody (H00004520-M01)

Discover more about diseases related to MTF1 Antibody (H00004520-M01).
 

Pathways for MTF1 Antibody (H00004520-M01)

View related products by pathway.

PTMs for MTF1 Antibody (H00004520-M01)

Learn more about PTMs related to MTF1 Antibody (H00004520-M01).

Blogs on MTF1

There are no specific blogs for MTF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTF1 Antibody (2E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MTF1
Entrez
OMIM
Uniprot