MST3 Antibody [DyLight 650]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

MST3 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 312-431 of human MST3 (NP_001027467.2).
  
  Sequence:
  TDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK24
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for MST3 Antibody [DyLight 650]

• EC 2.7.11
• EC 2.7.11.1
• Mammalian STE20-like protein kinase 3
• MST-3
• MST3serine/threonine kinase 24 (Ste20, yeast homolog)
• serine/threonine kinase 24
• serine/threonine-protein kinase 24
• STE20
• STE20-like kinase 3
• STE20-like kinase MST3
• sterile 20-like kinase 3
• STK3yeast)

Background

The growth of axons is fundamental to the development and repair of brain circuitry. It has been shown that Mst3, a neuron-specific homolog of the yeast kinase Ste20, is critical for axon outgrowth. Mst3 is activated in response to trophic factors, and suppressing its expression or its function blocks axon outgrowth (1). Mst3 has been recently demonstrated to undergo a caspase-mediated cleavage during apoptosis. The proteolytic cleavage of the C-terminus of Mst3 caused nuclear translocation of its kinase domain. Mst3 contains both nuclear localization sequence (NLS) and NES signals, which may cooperate to control the subcellular distribution of Mst3 (2). In situ hybridization of rat brain sections indicated that MST3b is widely expressed in different brain regions, with especially high expression in hippocampus and cerebral cortex. When expressed in human embryonic kidney 293 (HEK293) cells, MST3b effectively phosphorylated myelin basic protein, as well as undergoing autophosphorylation (3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK24