MSP/MST1 Recombinant Protein Antigen

Images

 
There are currently no images for MSP/MST1 Protein (NBP1-85330PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MSP/MST1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MST1.

Source: E. coli

Amino Acid Sequence: RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MST1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85330.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MSP/MST1 Recombinant Protein Antigen

  • D3F15S2
  • EC 3.4.21
  • hepatocyte growth factor-like protein homolog
  • HGFL
  • HGFLhepatocyte growth factor-like protein
  • macrophage stimulating 1 (hepatocyte growth factor-like)
  • Macrophage stimulatory protein
  • Macrophage-stimulating protein
  • MSP
  • MSPDNF15S2
  • MST1
  • NF15S2
  • SF2

Background

Mammalian STE20-like kinase 1, or MST-1, is a serine/threonine kinase that, upon cleavage, has been implicated in the promotion of chromatin condensation. MST-1 is also known as KRS2 and STK4. The C-terminus of MST-1 contains two functional NESs (nuclear export signals), which are released upon caspase-mediated cleavage. The N-terminus portion of the protein then translocates to the nucleus and will promote chromatin condensation at sufficiently high levels. Full-length MST-1 is localized to the cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
294-HG
Species: Hu
Applications: BA
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-48017
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00006789-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-323
Species: Hu, Rt
Applications: WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-85330PEP
Species: Hu
Applications: AC

Publications for MSP/MST1 Protein (NBP1-85330PEP) (0)

There are no publications for MSP/MST1 Protein (NBP1-85330PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSP/MST1 Protein (NBP1-85330PEP) (0)

There are no reviews for MSP/MST1 Protein (NBP1-85330PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MSP/MST1 Protein (NBP1-85330PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSP/MST1 Products

Research Areas for MSP/MST1 Protein (NBP1-85330PEP)

Find related products by research area.

Blogs on MSP/MST1

There are no specific blogs for MSP/MST1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MSP/MST1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MST1