MSL3L1 Antibody - BSA Free

Western Blot: MSL3L1 Antibody [NBP3-10990] - Western blot analysis of MSL3L1 in Mouse Lung lysates. Antibody dilution at 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MSL3L1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse MSL3L1 (NP_034962.2). Peptide sequence VFAGFEGRRPNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVK
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MSL3L1 Antibody - BSA Free

• male-specific lethal 3 homolog (Drosophila)
• male-specific lethal 3 homolog
• male-specific lethal 3-like 1 (Drosophila)
• male-specific lethal-3 (Drosophila)-like 1
• Male-specific lethal-3 homolog 1
• Male-specific lethal-3 protein-like 1
• MSL3L1DKFZp586J1822
• MSL3-like 1

Background

MSL3L1 encodes a nuclear protein and has similarity to drosophila male-specific lethal-3 gene. The drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus this encoded protein is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. There are four alternatively spliced transcript variants of this gene encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MSL3