HCCS Antibody

Images

 
Western Blot: HCCS Antibody [NBP1-86577] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HCCS Antibody [NBP1-86577] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: HCCS Antibody [NBP1-86577] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.
Western Blot: HCCS Antibody [NBP1-86577] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HCCS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL
Specificity
Specificity of human, mouse, rat HCCS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HCCS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HCCS Protein (NBP1-86577PEP)
Publications
Read Publication using
NBP1-86577 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25255805).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HCCS Antibody

  • CCHLDKFZp779I1858
  • cytochrome c heme-lyase
  • cytochrome c-type heme lyase
  • EC 4.4.1.17
  • holocytochrome c synthase (cytochrome c heme-lyase)
  • holocytochrome c synthase
  • Holocytochrome c-type synthase
  • MCOPS7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-75476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000395-M01
Species: Hu
Applications: WB, ELISA
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65875
Species: Hu
NBP2-31703
Species: Hu
Applications: IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86577
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HCCS Antibody (NBP1-86577)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HCCS Antibody (NBP1-86577) (0)

There are no reviews for HCCS Antibody (NBP1-86577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HCCS Antibody (NBP1-86577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HCCS Antibody (NBP1-86577)

Discover related pathways, diseases and genes to HCCS Antibody (NBP1-86577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HCCS Antibody (NBP1-86577)

Discover more about diseases related to HCCS Antibody (NBP1-86577).
 

Pathways for HCCS Antibody (NBP1-86577)

View related products by pathway.

PTMs for HCCS Antibody (NBP1-86577)

Learn more about PTMs related to HCCS Antibody (NBP1-86577).

Blogs on HCCS

There are no specific blogs for HCCS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HCCS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HCCS