MSL3L1 Antibody

Images

 
Western Blot: MSL3L1 Antibody [NBP1-87881] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: MSL3L1 Antibody [NBP1-87881] - staining of human lymph node shows moderate cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MSL3L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRRSTRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MSL3L1 Protein (NBP1-87881PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MSL3L1 Antibody

  • male-specific lethal 3 homolog (Drosophila)
  • male-specific lethal 3 homolog
  • male-specific lethal 3-like 1 (Drosophila)
  • male-specific lethal-3 (Drosophila)-like 1
  • Male-specific lethal-3 homolog 1
  • Male-specific lethal-3 protein-like 1
  • MSL3L1DKFZp586J1822
  • MSL3-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-45893
Species: Hu
Applications: WB, IHC
49130002
Species: Ce
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF844
Species: Mu
Applications: WB, Block
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP1-86577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-89355
Species: Hu
Applications: IHC, IHC-P
NBP1-85157
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87881
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MSL3L1 Antibody (NBP1-87881) (0)

There are no publications for MSL3L1 Antibody (NBP1-87881).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSL3L1 Antibody (NBP1-87881) (0)

There are no reviews for MSL3L1 Antibody (NBP1-87881). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSL3L1 Antibody (NBP1-87881) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSL3L1 Products

Bioinformatics Tool for MSL3L1 Antibody (NBP1-87881)

Discover related pathways, diseases and genes to MSL3L1 Antibody (NBP1-87881). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSL3L1 Antibody (NBP1-87881)

Discover more about diseases related to MSL3L1 Antibody (NBP1-87881).
 

Pathways for MSL3L1 Antibody (NBP1-87881)

View related products by pathway.

PTMs for MSL3L1 Antibody (NBP1-87881)

Learn more about PTMs related to MSL3L1 Antibody (NBP1-87881).

Blogs on MSL3L1

There are no specific blogs for MSL3L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSL3L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSL3
Entrez
Uniprot