MS4A7 Antibody (2D3)

Images

 
Western Blot: MS4A7 Antibody (2D3) [H00058475-M06] - Analysis of MS4A7 expression in transfected 293T cell line by MS4A7 monoclonal antibody (M06), clone 2D3. Lane 1: MS4A7 transfected lysatE (26.1 KDa). Lane 2: ...read more
Western Blot: MS4A7 Antibody (2D3) [H00058475-M06] - Western blot analysis of MS4A7 over-expressed 293 cell line, cotransfected with MS4A7 Validated Chimera RNAi or non-transfected control. Blot probed with ...read more
ELISA: MS4A7 Antibody (2D3) [H00058475-M06] - Detection limit for recombinant GST tagged MS4A7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA
Clone
2D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MS4A7 Antibody (2D3) Summary

Immunogen
MS4A7 (AAH20673, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
Specificity
MS4A7 - membrane-spanning 4-domains, subfamily A, member 7
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MS4A7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MS4A7 Antibody (2D3)

  • 4SPAN2
  • CD20/FC-epsilon-RI-beta family member 4
  • CD20L4
  • CD20L4MGC22368
  • CFFM4
  • CFFM4CD20 antigen-like 4
  • CFFMA
  • Four-span transmembrane protein 2
  • high affinity immunoglobulin epsilon receptor beta subunit
  • membrane-spanning 4-domains subfamily A member 7
  • membrane-spanning 4-domains, subfamily A, member 7,4SPAN2
  • MS4A7
  • MS4A8

Background

This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP1-85599
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
MAB6247
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00200576-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-45455
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB6166
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
AF5627
Species: Mu
Applications: WB
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-90895
Species: Hu
Applications: IHC, IHC-P
NBP2-49558
Species: Hu
Applications: IHC, IHC-P
H00058475-M06
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA

Publications for MS4A7 Antibody (H00058475-M06) (0)

There are no publications for MS4A7 Antibody (H00058475-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A7 Antibody (H00058475-M06) (0)

There are no reviews for MS4A7 Antibody (H00058475-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A7 Antibody (H00058475-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MS4A7 Products

Array H00058475-M06

Bioinformatics Tool for MS4A7 Antibody (H00058475-M06)

Discover related pathways, diseases and genes to MS4A7 Antibody (H00058475-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A7 Antibody (H00058475-M06)

Discover more about diseases related to MS4A7 Antibody (H00058475-M06).
 

Pathways for MS4A7 Antibody (H00058475-M06)

View related products by pathway.

PTMs for MS4A7 Antibody (H00058475-M06)

Learn more about PTMs related to MS4A7 Antibody (H00058475-M06).

Blogs on MS4A7

There are no specific blogs for MS4A7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A7 Antibody (2D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A7
Entrez
OMIM
Uniprot