Recombinant Human MS4A6A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MS4A6A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-248 of Human MS4A6A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MS4A6A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
52.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MS4A6A Protein

  • 4SPAN3
  • CD20 antigen-like 3
  • CD20L3
  • CD20L3MS4A6A-polymorph
  • CD20-like precusor
  • CDA01
  • Four-span transmembrane protein 3
  • four-span transmembrane protein 3.1,4SPAN3.2
  • four-span transmembrane protein 3.2
  • HAIRB-iso
  • membrane-spanning 4-domains subfamily A member 6A
  • membrane-spanning 4-domains, subfamily A, member 6A
  • MGC131944
  • MGC22650
  • MS4A6A
  • MS4A6MST090
  • MST090
  • MSTP090

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89102
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF638
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-163
Species: Mu
Applications: WB, Flow, IHC-P
NBP1-90625
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90895
Species: Hu
Applications: IHC, IHC-P
NBP2-52667
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP, B/N, CyTOF-ready
NBP1-86543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86542
Species: Hu
Applications: IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
7268-CT
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00245802-P01
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF2338
Species: Hu
Applications: WB, IP, ICC
H00064231-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MS4A6A Recombinant Protein (H00064231-P01) (0)

There are no publications for MS4A6A Recombinant Protein (H00064231-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A6A Recombinant Protein (H00064231-P01) (0)

There are no reviews for MS4A6A Recombinant Protein (H00064231-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A6A Recombinant Protein (H00064231-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MS4A6A Recombinant Protein (H00064231-P01)

Discover related pathways, diseases and genes to MS4A6A Recombinant Protein (H00064231-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A6A Recombinant Protein (H00064231-P01)

Discover more about diseases related to MS4A6A Recombinant Protein (H00064231-P01).
 

Pathways for MS4A6A Recombinant Protein (H00064231-P01)

View related products by pathway.

Blogs on MS4A6A

There are no specific blogs for MS4A6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CTLA-4
7268-CT-100

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MS4A6A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A6A
Entrez