MS4A4A Antibody - BSA Free

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542] - Staining of human small intestine shows positivity in lymphoid cells.

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542] - Staining of human lymph node shows membranous positivity in lymphoid cells.

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542] - Staining of human placenta shows membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MS4A4A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MS4A4A Antibody - BSA Free (NBP1-86542) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MS4A4A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MS4A4A Protein (NBP1-86542PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MS4A4A Antibody - BSA Free

• 4SPAN1
• CD20 antigen-like 1
• CD20L1
• CD20L1CD20-L1
• Fc epsilon receptor beta subunit homolog
• Four-span transmembrane protein 1
• membrane-spanning 4-domains subfamily A member 4A
• membrane-spanning 4-domains, subfamily A, member 4
• membrane-spanning 4-domains, subfamily A, member 4A
• MS4A4
• MS4A4A
• MS4A4MGC22311
• MS4A7

Background

MS4A4A encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MS4A4A