MRPS35 Antibody - BSA Free

Western Blot: MRPS35 Antibody [NBP1-82786] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: MRPS35 Antibody [NBP1-82786] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining in human kidney and pancreas tissues using anti-MRPS35 antibody. Corresponding MRPS35 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS35 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS35
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPS35 Protein (NBP1-82786PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPS35 Antibody - BSA Free

• 28S ribosomal protein S28, mitochondrial
• DKFZp762P093
• MDS023,28S ribosomal protein S35, mitochondrial
• MGC104278
• mitochondrial ribosomal protein S28
• mitochondrial ribosomal protein S35
• MRP-S28
• MRPS28S35mt
• MRP-S35
• S28mt

Background

MRPS35, or Mitochondrial Ribosomal Protein S35, contains a 37 kDa and a 33 kDa isoform, and is involved in protein synthesis within the mitochondria. The protein is not currently being used in any disease research. MRPS35 has been linked to the DNA damage response and the peptide biosynthetic process, through which it interacts with several other proteins, including ICT1, USP42, UBC, ESR1, and B9D1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS35