MRPS31 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MRPS31 Antibody [NBP2-30923] - Staining of human cell line HEK 293 shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry: MRPS31 Antibody [NBP2-30923] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS31 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DLLGIIKGMKVELSTVNVRTTKPPKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADSLPFDKQTTKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPS31 Protein (NBP2-30923PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS31 Antibody

  • 28S ribosomal protein S31, mitochondrial
  • IMOGN38Imogen 38
  • mitochondrial ribosomal protein S31
  • MRP-S31
  • S31mt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF4885
Species: Mu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25236
Species: Hu
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF4627
Species: Mu
Applications: WB, IHC
AF7109
Species: Mu
Applications: WB, IHC
NBP1-76823
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03982
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-33863
Species: Hu
Applications: WB, IHC, IHC-P
AF3756
Species: Hu, Mu, Rt
Applications: WB
NBP1-88578
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MRPS31 Antibody (NBP2-30923) (0)

There are no publications for MRPS31 Antibody (NBP2-30923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS31 Antibody (NBP2-30923) (0)

There are no reviews for MRPS31 Antibody (NBP2-30923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MRPS31 Antibody (NBP2-30923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS31 Products

Bioinformatics Tool for MRPS31 Antibody (NBP2-30923)

Discover related pathways, diseases and genes to MRPS31 Antibody (NBP2-30923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS31 Antibody (NBP2-30923)

Discover more about diseases related to MRPS31 Antibody (NBP2-30923).
 

Pathways for MRPS31 Antibody (NBP2-30923)

View related products by pathway.

Blogs on MRPS31

There are no specific blogs for MRPS31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS31
Uniprot