MRPS31 Antibody (3J3T5)

Western Blot: MRPS31 Antibody (3J3T5) [NBP3-33240] - Western blot analysis of various lysates using MRPS31 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

Western Blot: MRPS31 Antibody (3J3T5) [NBP3-33240] - Western blot analysis of various lysates using MRPS31 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 3J3T5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MRPS31 Antibody (3J3T5) Summary

• Description: Novus Biologicals Rabbit MRPS31 Antibody (3J3T5) (NBP3-33240) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 296-395 of human MRPS31 (Q92665).
  
  Sequence:
  NGFEELIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKKDILKESNIQFN
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MRPS31
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRPS31 Antibody (3J3T5)

• 28S ribosomal protein S31, mitochondrial
• IMOGN38Imogen 38
• mitochondrial ribosomal protein S31
• MRP-S31
• S31mt

Background

MRPS31, also known as Mitochondrial Ribosomal Protein S31, contains a 45 kDa isoform that is 395 amino acids in length, and is involved in protein synthesis within the mitochondria. MRPS31 is not currently being utilized in disease research. The protein is not associated with any pathways or biological processes, but has been found to interact with USP42, ESR1, ITGB3BP, SLX4, and LYST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS31