Recombinant Human MRPS18B Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MRPS18B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-258 of Human MRPS18B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MRPS18B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
54.12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPS18B Protein

  • 28S ribosomal protein S18-2, mitochondrial
  • C6orf1428S ribosomal protein S18b, mitochondrial
  • HSPC183
  • HumanS18a
  • mitochondrial ribosomal protein S18-2
  • mitochondrial ribosomal protein S18B
  • MRP-S18-2
  • MRPS18-2DKFZp564H0223
  • MRP-S18-b
  • mrps18-b
  • PTD017
  • S18amt
  • S18mt-b

Background

MRPS18B( AAH05373, 1 a.a. - 259 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-13263
Species: Hu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-83430
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-15581
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83210
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56414
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30930
Species: Hu
Applications: IHC, IHC-P
NBP2-49627
Species: Hu
Applications: WB, IHC, IHC-P
NB100-395
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB600-936
Species: Hu, Mu, Rt, Po, Bv, Ch, ChHa, In, Pm, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, Single Cell Western

Publications for MRPS18B Recombinant Protein (H00028973-P01) (0)

There are no publications for MRPS18B Recombinant Protein (H00028973-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS18B Recombinant Protein (H00028973-P01) (0)

There are no reviews for MRPS18B Recombinant Protein (H00028973-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS18B Recombinant Protein (H00028973-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MRPS18B Recombinant Protein (H00028973-P01)

Discover related pathways, diseases and genes to MRPS18B Recombinant Protein (H00028973-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MRPS18B Recombinant Protein (H00028973-P01)

Find related products by research area.

Blogs on MRPS18B

There are no specific blogs for MRPS18B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRPS18B Antibody
NBP2-48792
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPS18B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS18B