MRPS18B Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MRPS18B Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS18B.
  
  

  Source: E. coli

  Amino Acid Sequence: GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MRPS18B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48792.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking peptide related information and a protocol, click here.

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPS18B Recombinant Protein Antigen

• 28S ribosomal protein S18-2, mitochondrial
• C6orf1428S ribosomal protein S18b, mitochondrial
• HSPC183
• HumanS18a
• mitochondrial ribosomal protein S18-2
• mitochondrial ribosomal protein S18B
• MRP-S18-2
• MRPS18-2DKFZp564H0223
• MRP-S18-b
• mrps18-b
• PTD017
• S18amt
• S18mt-b

Background

Mitochondrial ribosomal protein S18B (MRPS18B), also known as 28S ribosomal protein S18b, ribosomal protein S18-2, C6orf14, PTD017, S18amt, HSPC183, and MRP-S18-2, is a member of the ribosomal protein S18P family. Members of this family assist in protein synthesis and are encoded by nuclear genes. The MRPS18B protein is one of three members of the family that has significant sequence similarity to bacterial S18 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS18B