MRPL41 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MRPL41 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPL41.
  
  

  Source: E. coli

  Amino Acid Sequence: GADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MRPL41
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88571.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPL41 Recombinant Protein Antigen

• Bcl-2-interacting mitochondrial ribosomal protein L41,39S ribosomal protein L41, mitochondrial
• BMRPMRP-L41
• Cell proliferation-inducing gene 3 protein
• mitochondrial ribosomal protein L41,39S ribosomal protein L27 homolog
• MRP-L27
• MRPL27L41mt
• PIG3
• proliferation-inducing gene 3
• RPML27MRP-L27 homolog

Background

MRPL41, also known as 39 S ribosomal protein L41, mitochondrial, is a 15.4 kDa, 137 amino acid protein that is involved in the cell cycle and apoptosis as a component of the large subunit of ribosomes in the mitochondria. Current research is investigating the effect of the protein on diseases such as breast cancer and duodenogastric reflux. The protein interacts with SMURF2, C20orf24, ICT1, SLX4, and TRIM63 proteins in cell cycle pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MRPL41