Recombinant Human MRCK Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MRCK Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 551-650 of Human CDC42BPA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLRE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDC42BPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRCK Protein

  • CDC42 binding protein kinase alpha (DMPK-like)
  • CDC42 binidng protein kinase beta
  • CDC42-binding protein kinase alpha (DMPK-like)
  • CDC42-binding protein kinase alpha
  • DMPK-like alpha
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0451DKFZp686L1738
  • MRCK alpha
  • MRCK
  • MRCKADKFZp686P1738
  • Myotonic dystrophy kinase-related CDC42-binding kinase alpha
  • myotonic dystrophy kinase-related CDC42-binding protein kinase alpha
  • Myotonic dystrophy protein kinase-like alpha
  • PK428FLJ23347
  • serine/threonine-protein kinase MRCK alpha
  • ser-thr protein kinase PK428
  • ser-thr protein kinase related to the myotonic dystrophy protein kinase

Background

CDC42BPA - CDC42 binding protein kinase alpha (DMPK-like)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009578-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79840
Species: Hu
Applications: WB (-), IP
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF2584
Species: Mu
Applications: WB, Simple Western
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84072
Species: Hu
Applications: IHC, IHC-P
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MRCK Partial Recombinant Protein (H00008476-Q01) (0)

There are no publications for MRCK Partial Recombinant Protein (H00008476-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRCK Partial Recombinant Protein (H00008476-Q01) (0)

There are no reviews for MRCK Partial Recombinant Protein (H00008476-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRCK Partial Recombinant Protein (H00008476-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRCK Products

Bioinformatics Tool for MRCK Partial Recombinant Protein (H00008476-Q01)

Discover related pathways, diseases and genes to MRCK Partial Recombinant Protein (H00008476-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRCK Partial Recombinant Protein (H00008476-Q01)

Discover more about diseases related to MRCK Partial Recombinant Protein (H00008476-Q01).
 

Pathways for MRCK Partial Recombinant Protein (H00008476-Q01)

View related products by pathway.

PTMs for MRCK Partial Recombinant Protein (H00008476-Q01)

Learn more about PTMs related to MRCK Partial Recombinant Protein (H00008476-Q01).
 

Research Areas for MRCK Partial Recombinant Protein (H00008476-Q01)

Find related products by research area.

Blogs on MRCK

There are no specific blogs for MRCK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRCK Antibody
NB300-829

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRCK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42BPA