Recombinant Human MRCK GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human MRCK GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 551-650 of Human MRCK
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: LVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLRE

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: CDC42BPA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRCK GST (N-Term) Protein

• CDC42 binding protein kinase alpha (DMPK-like)
• CDC42 binidng protein kinase beta
• CDC42-binding protein kinase alpha (DMPK-like)
• CDC42-binding protein kinase alpha
• DMPK-like alpha
• EC 2.7.11
• EC 2.7.11.1
• KIAA0451DKFZp686L1738
• MRCK alpha
• MRCK
• MRCKADKFZp686P1738
• Myotonic dystrophy kinase-related CDC42-binding kinase alpha
• myotonic dystrophy kinase-related CDC42-binding protein kinase alpha
• Myotonic dystrophy protein kinase-like alpha
• PK428FLJ23347
• serine/threonine-protein kinase MRCK alpha
• ser-thr protein kinase PK428
• ser-thr protein kinase related to the myotonic dystrophy protein kinase

Background

CDC42BPA - CDC42 binding protein kinase alpha (DMPK-like)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CDC42BPA