Mrc2 Recombinant Protein Antigen

Images

 
There are currently no images for Mrc2 Protein (NBP1-85768PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Mrc2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRC2.

Source: E. coli

Amino Acid Sequence: EEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MRC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85768.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mrc2 Recombinant Protein Antigen

  • CD280 antigen
  • CD280
  • CD280C-type mannose receptor 2
  • CLEC13E
  • CLEC13EUPAR-associated protein
  • Endo180
  • ENDO180C-type lectin domain family 13 member E
  • Endocytic receptor 180
  • KIAA0709FLJ35911
  • Macrophage mannose receptor 2
  • mannose receptor, C type 2
  • Mrc2
  • uPARAP
  • UPARAPendocytic receptor (macrophage mannose receptor family)
  • urokinase plasminogen activator receptor-associated protein
  • Urokinase receptor-associated protein
  • Urokinase-type plasminogen activator receptor-associated protein

Background

MRC2, also known as C-type mannose receptor 2, is a 1,479 amino acid protein that is 167 kDa, plays a role in extracellular matrix remodeling by mediating the internalization and lysosomal degradation of collagen ligands, may be involved in plasminogen activation system controlling the extracellular level of PLAUR/PLAU, and thus may regulate protease activity at the cell surface, and may play a role in the tumorigenesis and metastasis of several malignancies including breast cancer, gliomas and metastatic bone disease. Disease research is currently being studied with relations to MRC2 and breast cancer, aortic aneurysm, prostate cancer, progression of osteoarthritis, prostatitis,s, schizophrenia, tuberculosis, immunodeficiency, and hepatitis. Interactions with this protein have shown to involve NDEL1, IL10, TGFB1, TGFB2, TGFB3, and UBC in antigen processing-cross presentation, cross-presentation of soluble exogenous antigens (endosomes), adaptive immune system, class I MHC mediated antigen processing & presentation, immune system, phagosome, and tuberculosis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DUP00
Species: Hu
Applications: ELISA
1310-SE
Species: Hu
Applications: EnzAct
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NBP3-46903
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF5975
Species: Mu
Applications: WB
DM1300
Species: Hu
Applications: ELISA
MAB9181
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
AF2535
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NBP1-85768PEP
Species: Hu
Applications: AC

Publications for Mrc2 Protein (NBP1-85768PEP) (0)

There are no publications for Mrc2 Protein (NBP1-85768PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mrc2 Protein (NBP1-85768PEP) (0)

There are no reviews for Mrc2 Protein (NBP1-85768PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Mrc2 Protein (NBP1-85768PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mrc2 Products

Research Areas for Mrc2 Protein (NBP1-85768PEP)

Find related products by research area.

Blogs on Mrc2

There are no specific blogs for Mrc2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Mrc2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MRC2