Recombinant Human MOS Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MOS Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 247-346 of Human MOS

Source: Wheat Germ

Amino Acid Sequence: APELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MOS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MOS Protein

  • c-mos
  • EC 2.7.11
  • EC 2.7.11.1
  • MGC119962
  • MGC119963
  • MSV
  • oncogene MOS, Moloney murine sarcoma virus
  • Oocyte maturation factor mos
  • Proto-oncogene c-Mos
  • proto-oncogene serine/threonine-protein kinase mos
  • v-mos Moloney murine sarcoma viral oncogene homolog

Background

MOS - v-mos Moloney murine sarcoma viral oncogene homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P, KD
AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC

Publications for MOS Partial Recombinant Protein (H00004342-Q01) (0)

There are no publications for MOS Partial Recombinant Protein (H00004342-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOS Partial Recombinant Protein (H00004342-Q01) (0)

There are no reviews for MOS Partial Recombinant Protein (H00004342-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOS Partial Recombinant Protein (H00004342-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOS Products

Bioinformatics Tool for MOS Partial Recombinant Protein (H00004342-Q01)

Discover related pathways, diseases and genes to MOS Partial Recombinant Protein (H00004342-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOS Partial Recombinant Protein (H00004342-Q01)

Discover more about diseases related to MOS Partial Recombinant Protein (H00004342-Q01).
 

Pathways for MOS Partial Recombinant Protein (H00004342-Q01)

View related products by pathway.

PTMs for MOS Partial Recombinant Protein (H00004342-Q01)

Learn more about PTMs related to MOS Partial Recombinant Protein (H00004342-Q01).
 

Research Areas for MOS Partial Recombinant Protein (H00004342-Q01)

Find related products by research area.

Blogs on MOS

There are no specific blogs for MOS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GM-CSF [Unconjugated]
215-GM-010/CF
MOS Antibody
NBP1-86241

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MOS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MOS