Recombinant Human Morg1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Morg1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-315 of Human MORG1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
WDR83

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Morg1 Protein

  • MAPK organizer 1
  • MGC4238
  • MORG1Mitogen-activated protein kinase organizer 1
  • WD repeat domain 83
  • WD repeat domain-containing protein 83

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-139
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-81257
Species: Hu
Applications: IHC, IHC-P
NBP1-50631
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-81728
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for Morg1 Recombinant Protein (H00084292-P01) (0)

There are no publications for Morg1 Recombinant Protein (H00084292-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Morg1 Recombinant Protein (H00084292-P01) (0)

There are no reviews for Morg1 Recombinant Protein (H00084292-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Morg1 Recombinant Protein (H00084292-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Morg1 Products

Bioinformatics Tool for Morg1 Recombinant Protein (H00084292-P01)

Discover related pathways, diseases and genes to Morg1 Recombinant Protein (H00084292-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Morg1 Recombinant Protein (H00084292-P01)

Discover more about diseases related to Morg1 Recombinant Protein (H00084292-P01).
 

Pathways for Morg1 Recombinant Protein (H00084292-P01)

View related products by pathway.

Research Areas for Morg1 Recombinant Protein (H00084292-P01)

Find related products by research area.

Blogs on Morg1

There are no specific blogs for Morg1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Morg1 Antibody
NBP1-92132

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Morg1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR83