MORF4L2 Recombinant Protein Antigen

Images

 
There are currently no images for MORF4L2 Recombinant Protein Antigen (NBP2-58131PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MORF4L2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to MORF4L2.

Source: E. coli

Amino Acid Sequence: QPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MORF4L2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58131.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MORF4L2 Recombinant Protein Antigen

  • KIAA0026MRGXProtein MSL3-2
  • MORFL2
  • MORF-related gene X protein
  • mortality factor 4 like 2
  • mortality factor 4-like protein 2
  • MSL3-2 protein
  • Transcription factor-like protein MRGX

Background

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit HTATIP/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP and YEATS4/GAS41. The NuA4 complex interacts with MYC and the adenovirus E1A protein. MORF4L1 may also participate in the formation of NuA4 related complexes which lack the HTATIP/TIP60 catalytic subunit, but which include the SWI/SNF related protein SRCAP. Component of the MSIN3A histone deacetylase complex, which includes SIN3A, HDAC2, ARID4B, MORF4L1, RBBP4/RbAp48, and RBBP7/RbAp46. MORF4L1 interacts with RB1 and MYST1. MORF4L1 may also interact with PHF12 and one or more as yet undefined members of the TLE (transducin-like enhancer of split) family of transcriptional repressors. MRGX plays a role in growth regulation and replicative senescence. Expression of MRGX, which initially increases during cell cycle, may have to decrease for cells to enter the S phase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1307
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
H00004605-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-26148
Species: Hu, Rt
Applications: ELISA, Flow, ICC/IF, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB110-75035
Species: Ha(-), Hu, Mu
Applications: ICC/IF, IHC, KD, Single-Cell Western, WB
NBP3-27150
Species: Hu
Applications: ELISA, WB
NBP1-84936
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47052
Species: Hu
Applications: ELISA, IHC, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP3-14409
Species: Hu
Applications: IHC,  IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-58131PEP
Species: Hu
Applications: AC

Publications for MORF4L2 Recombinant Protein Antigen (NBP2-58131PEP) (0)

There are no publications for MORF4L2 Recombinant Protein Antigen (NBP2-58131PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MORF4L2 Recombinant Protein Antigen (NBP2-58131PEP) (0)

There are no reviews for MORF4L2 Recombinant Protein Antigen (NBP2-58131PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MORF4L2 Recombinant Protein Antigen (NBP2-58131PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MORF4L2 Products

Research Areas for MORF4L2 Recombinant Protein Antigen (NBP2-58131PEP)

Find related products by research area.

Blogs on MORF4L2

There are no specific blogs for MORF4L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MORF4L2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MORF4L2