Recombinant Human MOGAT2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MOGAT2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-284 of Human MOGAT2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGYQASGKSTLGSVGNWQGFYFGGKMAETNADSILVEIFSPFTIKIIFWCLMPKYLEKFPQRRLSDLRN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MOGAT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
58.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MOGAT2 Protein

  • acyl CoA:monoacylglycerol acyltransferase 2
  • Acyl-CoA:monoacylglycerol acyltransferase 2
  • DC5
  • DGAT2L5MGC119183
  • Diacylglycerol acyltransferase 2-like protein 5
  • Diacylglycerol O-acyltransferase candidate 5
  • EC 2.3.1
  • EC 2.3.1.22
  • FLJ22644
  • hDC5
  • hMGAT2
  • MGAT2MGC119184
  • MGC119185
  • monoacylglycerol O-acyltransferase 22-acylglycerol O-acyltransferase 2

Background

Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81827
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-84299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP1-81810
Species: Hu
Applications: IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
NBP1-88641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3369
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF2569
Species: Hu
Applications: WB, ICC
NB100-1872
Species: Hu, Mu, Rt
Applications: WB, Flow
MAB8864
Species: Hu
Applications: IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00080168-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MOGAT2 Recombinant Protein (H00080168-P01) (0)

There are no publications for MOGAT2 Recombinant Protein (H00080168-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOGAT2 Recombinant Protein (H00080168-P01) (0)

There are no reviews for MOGAT2 Recombinant Protein (H00080168-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOGAT2 Recombinant Protein (H00080168-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MOGAT2 Recombinant Protein (H00080168-P01)

Discover related pathways, diseases and genes to MOGAT2 Recombinant Protein (H00080168-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOGAT2 Recombinant Protein (H00080168-P01)

Discover more about diseases related to MOGAT2 Recombinant Protein (H00080168-P01).
 

Pathways for MOGAT2 Recombinant Protein (H00080168-P01)

View related products by pathway.

PTMs for MOGAT2 Recombinant Protein (H00080168-P01)

Learn more about PTMs related to MOGAT2 Recombinant Protein (H00080168-P01).

Blogs on MOGAT2

There are no specific blogs for MOGAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MOGAT2 Antibody
NBP1-85230

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MOGAT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MOGAT2