Recombinant Human MOGAT2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MOGAT2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 44-106 of Human MOGAT2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MOGAT2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MOGAT2 Protein

  • acyl CoA:monoacylglycerol acyltransferase 2
  • Acyl-CoA:monoacylglycerol acyltransferase 2
  • DC5
  • DGAT2L5MGC119183
  • Diacylglycerol acyltransferase 2-like protein 5
  • Diacylglycerol O-acyltransferase candidate 5
  • EC 2.3.1
  • EC 2.3.1.22
  • FLJ22644
  • hDC5
  • hMGAT2
  • MGAT2MGC119184
  • MGC119185
  • monoacylglycerol O-acyltransferase 22-acylglycerol O-acyltransferase 2

Background

MOGAT2 - monoacylglycerol O-acyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81827
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-84299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-88641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF3369
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF2569
Species: Hu
Applications: WB, ICC
NBP2-33664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8864
Species: Hu
Applications: IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00080168-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MOGAT2 Partial Recombinant Protein (H00080168-Q01) (0)

There are no publications for MOGAT2 Partial Recombinant Protein (H00080168-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOGAT2 Partial Recombinant Protein (H00080168-Q01) (0)

There are no reviews for MOGAT2 Partial Recombinant Protein (H00080168-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOGAT2 Partial Recombinant Protein (H00080168-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOGAT2 Products

Bioinformatics Tool for MOGAT2 Partial Recombinant Protein (H00080168-Q01)

Discover related pathways, diseases and genes to MOGAT2 Partial Recombinant Protein (H00080168-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOGAT2 Partial Recombinant Protein (H00080168-Q01)

Discover more about diseases related to MOGAT2 Partial Recombinant Protein (H00080168-Q01).
 

Pathways for MOGAT2 Partial Recombinant Protein (H00080168-Q01)

View related products by pathway.

PTMs for MOGAT2 Partial Recombinant Protein (H00080168-Q01)

Learn more about PTMs related to MOGAT2 Partial Recombinant Protein (H00080168-Q01).

Blogs on MOGAT2

There are no specific blogs for MOGAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MOGAT2 Antibody
NBP1-85230

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MOGAT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MOGAT2