Moesin Antibody (4B8) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
MSN (NP_002435, 422 a.a. ~ 531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELAN |
| Specificity |
MSN - moesin (4B8) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MSN |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Moesin Antibody (4B8) - Azide and BSA Free
Background
Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Rt
Applications: Flow, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Publications for Moesin Antibody (H00004478-M13) (0)
There are no publications for Moesin Antibody (H00004478-M13).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Moesin Antibody (H00004478-M13) (0)
There are no reviews for Moesin Antibody (H00004478-M13).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Moesin Antibody (H00004478-M13). (Showing 1 - 1 of 1 FAQ).
-
I am looking to use shRNA to inhibit Moesin expression. I have had people advise me that my initial MOI should be low as 'less is more' and 'a little goes a long way' in terms of siRNA. I was wondering if you could elaborate on this for me and explain why my initial MOI should be low.
- The reason for a low MOI is most likely because RNAi is a very strong and efficient technique. Wikipedia does a good job of explaining <a href="http://en.wikipedia.org/wiki/RNA_interference" target="_blank">RNA interference</a>. However, I would imagine that in a cell, there will be at most 1-2 copies of the gene mRNA present at any given time, unless you're dealing with a highly expressed protein such as Actin, where I would imagine silencing Actin would be lethal to the cell. I can imagine a few reasons to not use too much siRNA. First, it is expensive, so you don't want to waste it. Second, using too much would cause there to be a lot of non-translatable RNA present in the cell, which could trigger an immune response, as the presence of uncapped RNAs can indicate presence of a virus and one of the TLRs may respond to this.
Secondary Antibodies
| |
Isotype Controls
|
Additional Moesin Products
Research Areas for Moesin Antibody (H00004478-M13)
Find related products by research area.
|
Blogs on Moesin