Recombinant Human MOCS3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MOCS3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-460 of Human MOCS3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY

Protein/Peptide Type
Recombinant Protein
Gene
MOCS3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MOCS3 Protein

  • adenylyltransferase and sulfurtransferase MOCS3
  • dJ914P20.3
  • molybdenum cofactor synthesis 3
  • Molybdenum cofactor synthesis protein 3
  • Molybdopterin synthase sulfurylase
  • MPT synthase sulfurylase
  • UBA4, ubiquitin-activating enzyme E1 homolog
  • UBA4MGC9252
  • ubiquitin-like modifier activating enzyme 4

Background

MOCS3( AAH15939, 1 a.a. - 461 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

UL-950
Species: Hu
NBP1-81045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92130
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46161
Species: Hu
Applications: WB, IHC
NBP1-32423
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88457
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5928
Species: Hu
Applications: WB, IHC, ICC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-87770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP1-89266
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MOCS3 Recombinant Protein (H00027304-P01) (0)

There are no publications for MOCS3 Recombinant Protein (H00027304-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOCS3 Recombinant Protein (H00027304-P01) (0)

There are no reviews for MOCS3 Recombinant Protein (H00027304-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOCS3 Recombinant Protein (H00027304-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOCS3 Products

Bioinformatics Tool for MOCS3 Recombinant Protein (H00027304-P01)

Discover related pathways, diseases and genes to MOCS3 Recombinant Protein (H00027304-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOCS3 Recombinant Protein (H00027304-P01)

Discover more about diseases related to MOCS3 Recombinant Protein (H00027304-P01).
 

Pathways for MOCS3 Recombinant Protein (H00027304-P01)

View related products by pathway.

PTMs for MOCS3 Recombinant Protein (H00027304-P01)

Learn more about PTMs related to MOCS3 Recombinant Protein (H00027304-P01).

Blogs on MOCS3

There are no specific blogs for MOCS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SALL4 Antibody (6E3)
H00057167-M03
MOCS3 Antibody
NBP2-17320

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MOCS3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MOCS3