We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MOCS2 Recombinant Protein Antigen

Images

 
There are currently no images for MOCS2 Protein (NBP2-38359PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MOCS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MOCS2.

Source: E. coli

Amino Acid Sequence: TTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MOCS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38359.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MOCS2 Recombinant Protein Antigen

  • EC 2.-
  • MCBPE
  • MOCO1-A
  • MOCO1-B
  • MOCO1MOCS2B
  • MOCS2A
  • molybdenum cofactor biosynthesis protein E
  • molybdenum cofactor synthesis 2
  • Molybdenum cofactor synthesis protein 2 large subunit
  • Molybdenum cofactor synthesis protein 2 small subunit
  • Molybdenum cofactor synthesis protein 2A
  • Molybdenum cofactor synthesis protein 2B
  • molybdopterin synthase catalytic subunit
  • molybdopterin synthase sulfur carrier subunit
  • Molybdopterin-synthase large subunit
  • Molybdopterin-synthase small subunit
  • MPT synthase large subunit
  • MPTS
  • Sulfur carrier protein MOCS2A

Background

Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92130
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-03449
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-17320
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-32423
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5928
Species: Hu
Applications: ICC, IHC, WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-87148
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-68702
Species: Hu
Applications: IHC,  IHC-P
NBP1-89783
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83374
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP1-86665
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-45632
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-83299
Species: Hu
Applications: IHC,  IHC-P
NBP1-88223
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-97644
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-90095
Species: Hu
Applications:  IHC-P
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
NBP3-12450
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB

Publications for MOCS2 Protein (NBP2-38359PEP) (0)

There are no publications for MOCS2 Protein (NBP2-38359PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOCS2 Protein (NBP2-38359PEP) (0)

There are no reviews for MOCS2 Protein (NBP2-38359PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MOCS2 Protein (NBP2-38359PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOCS2 Products

Research Areas for MOCS2 Protein (NBP2-38359PEP)

Find related products by research area.

Blogs on MOCS2

There are no specific blogs for MOCS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MOCS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MOCS2