MNK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MNK1 Antibody [NBP2-56054] - Staining of human cell line HaCaT shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MNK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS
Specificity
Specificity of human MNK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MKNK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MNK1 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • MAP kinase interacting kinase 1
  • MAP kinase interacting serine/threonine kinase 1
  • MAP kinase signal-integrating kinase 1
  • MAP kinase-interacting serine/threonine-protein kinase 1
  • Mnk1
  • MNK1MAP kinase-interacting serine/threonine kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00002872-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, PLA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Po
Applications: WB, IP
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-56054
Species: Hu
Applications: ICC/IF

Publications for MNK1 Antibody (NBP2-56054) (0)

There are no publications for MNK1 Antibody (NBP2-56054).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MNK1 Antibody (NBP2-56054) (0)

There are no reviews for MNK1 Antibody (NBP2-56054). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MNK1 Antibody (NBP2-56054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MNK1 Products

Bioinformatics Tool for MNK1 Antibody (NBP2-56054)

Discover related pathways, diseases and genes to MNK1 Antibody (NBP2-56054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MNK1 Antibody (NBP2-56054)

Discover more about diseases related to MNK1 Antibody (NBP2-56054).
 

Pathways for MNK1 Antibody (NBP2-56054)

View related products by pathway.

PTMs for MNK1 Antibody (NBP2-56054)

Learn more about PTMs related to MNK1 Antibody (NBP2-56054).
 

Research Areas for MNK1 Antibody (NBP2-56054)

Find related products by research area.

Blogs on MNK1

There are no specific blogs for MNK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MNK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKNK1