MMP-9 Recombinant Protein Antigen

Images

 
There are currently no images for MMP-9 Recombinant Protein Antigen (NBP2-52948PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MMP-9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP-9.

Source: E. coli

Amino Acid Sequence: PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MMP9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52948.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMP-9 Recombinant Protein Antigen

  • 92 kDa gelatinase
  • 92 kDa type IV collagenase
  • CLG4B
  • EC 3.4.24
  • EC 3.4.24.35
  • Gelatinase B
  • GELB
  • macrophage gelatinase
  • MANDP2
  • matrix metallopeptidase 9
  • matrix metalloproteinase 9
  • matrix metalloproteinase-9
  • MMP9
  • MMP-9
  • type V collagenase

Background

Matrix metalloproteinases (MMPs) are zinc-dependent endopeptidases that degrade substances within the extracellular matrix. The MMP family includes six different groups of enzymes: collagenases, gelatinases, stromelysins, transmembrane MMPs, matrilysins and others. MMPs are secreted as proenzymes that have to be cleaved in order to be activated. Other MMPs, plasmins as well as other factors activate MMPs. MMPs are thought to play an important role in tissue remodeling associated with various physiological and pathological processes. MMP9 degrades of proteins in the extracellular matrix and activates growth factors like proTGF beta and proTNF alpha. MMP9 contributes to the invasion and metastasis of various human malignancies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
DTM100
Species: Hu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
DTM200
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
DMP300
Species: Hu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
1310-SE
Species: Hu
Applications: EnzAct
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
MAB9181
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
DM1300
Species: Hu
Applications: ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB

Publications for MMP-9 Recombinant Protein Antigen (NBP2-52948PEP) (0)

There are no publications for MMP-9 Recombinant Protein Antigen (NBP2-52948PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-9 Recombinant Protein Antigen (NBP2-52948PEP) (0)

There are no reviews for MMP-9 Recombinant Protein Antigen (NBP2-52948PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MMP-9 Recombinant Protein Antigen (NBP2-52948PEP). (Showing 1 - 1 of 1 FAQ).

  1.  I’m looking for a pair of antibodies to MMP-9 that can be used in a sandwich assay. Do you carry any? 
    • We have 10 primary antibodies for MMP-9 that have been tested in ELISA, seen here.It looks like 2 have been tested for capture (please note the tested species for each of these), seen here.6 have been tested for detection, seen here.

Additional MMP-9 Products

Research Areas for MMP-9 Recombinant Protein Antigen (NBP2-52948PEP)

Find related products by research area.

Blogs on MMP-9.

Cytokeratin 18 - A Intermediate Filament Cyotskeletal Component
Keratins, also called cytokeratins, are a family of filamentous structural proteins that form the intermediate filaments within epithelial cells. Keratins are differentially expressed depending on both the epithelial cell origin and degree of differen...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MMP-9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP9