MMP-25/MT6-MMP Recombinant Protein Antigen

Images

 
There are currently no images for MMP-25/MT6-MMP Recombinant Protein Antigen (NBP3-17275PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MMP-25/MT6-MMP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP-25/MT6-MMP

Source: E. coli

Amino Acid Sequence: ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MMP25
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17275.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMP-25/MT6-MMP Recombinant Protein Antigen

  • Leukolysin
  • matrix metallopeptidase 25
  • matrix metallopeptidase-like 1
  • matrix metalloproteinase 20
  • matrix metalloproteinase 25
  • matrix metalloproteinase-25
  • matrix metalloproteinase-like 1
  • membrane-type 6 matrix metalloproteinase
  • membrane-type matrix metalloproteinase 6
  • membrane-type-6 matrix metalloproteinase
  • MMP20
  • MMP20A
  • MMP25
  • MMP-25
  • MMPL1
  • MT6MMP
  • MT6-MMP
  • MT-MMP 6
  • MTMMP6
  • MT-MMP6

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as metastasis and arthritis. Most MMPs are secreted as inactive proproteins which are then activated when cleaved by extracellular proteinases. The protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily, and is attached to the plasma membrane via a glycosylphosphatidyl inositol anchor. The encoded protein is thought to inactivate alpha-1 proteinase inhibitor, a major tissue protectant against proteolytic enzymes released by activated neutrophils, facilitating the transendothelial migration of neutrophils to inflammatory sites in response to bacterial infection or inflammation. The encoded protein may also play a role in tumor invasion and metastasis through activation of MMP2. The gene has previously been referred to as MMP20 but has been renamed MMP25.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1719-SE
Species: Hu
Applications: EnzAct
H00010117-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3026
Species: Mu
Applications: WB
NBP2-15373
Species: Hu, Mu
Applications: WB
MAB9181
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
7796-MP
Species: Hu
Applications: EnzAct
NBP1-87446
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
AB924
Species: Hu, Mu
Applications: IHC, IP, WB
DMP900
Species: Hu
Applications: ELISA
NBP3-00124
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DMP300
Species: Hu
Applications: ELISA
AF6790
Species: Hu
Applications: IHC, WB
DTM100
Species: Hu
Applications: ELISA
AF1785
Species: Hu
Applications: IHC, IP, WB
DTM200
Species: Hu
Applications: ELISA
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
NBP3-17275PEP
Species: Hu
Applications: AC

Publications for MMP-25/MT6-MMP Recombinant Protein Antigen (NBP3-17275PEP) (0)

There are no publications for MMP-25/MT6-MMP Recombinant Protein Antigen (NBP3-17275PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-25/MT6-MMP Recombinant Protein Antigen (NBP3-17275PEP) (0)

There are no reviews for MMP-25/MT6-MMP Recombinant Protein Antigen (NBP3-17275PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MMP-25/MT6-MMP Recombinant Protein Antigen (NBP3-17275PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MMP-25/MT6-MMP Products

Research Areas for MMP-25/MT6-MMP Recombinant Protein Antigen (NBP3-17275PEP)

Find related products by research area.

Blogs on MMP-25/MT6-MMP

There are no specific blogs for MMP-25/MT6-MMP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MMP-25/MT6-MMP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP25