Recombinant Human MMD Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MMD Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-238 of Human MMD full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL

Protein/Peptide Type
Recombinant Protein
Gene
MMD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MMD Protein

  • MMA
  • monocyte to macrophage differentiation protein
  • monocyte to macrophage differentiation-associated
  • PAQR11macrophage maturation-associated
  • Progestin and adipoQ receptor family member 11
  • Progestin and adipoQ receptor family member XI

Background

This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been positively identified as a receptor. A suggested alternative function is that of an ion channel protein in maturing macrophages. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1131
Species: Hu, ArHa
Applications: WB, IHC, IHC-P, PEP-ELISA
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MMD Recombinant Protein (H00023531-P01) (0)

There are no publications for MMD Recombinant Protein (H00023531-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMD Recombinant Protein (H00023531-P01) (0)

There are no reviews for MMD Recombinant Protein (H00023531-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMD Recombinant Protein (H00023531-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MMD Products

MMD H00023531-P01

Bioinformatics Tool for MMD Recombinant Protein (H00023531-P01)

Discover related pathways, diseases and genes to MMD Recombinant Protein (H00023531-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMD Recombinant Protein (H00023531-P01)

Discover more about diseases related to MMD Recombinant Protein (H00023531-P01).
 

Pathways for MMD Recombinant Protein (H00023531-P01)

View related products by pathway.

PTMs for MMD Recombinant Protein (H00023531-P01)

Learn more about PTMs related to MMD Recombinant Protein (H00023531-P01).

Blogs on MMD

There are no specific blogs for MMD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MMD Antibody
NBP2-55515
iNOS Antibody
NB300-605

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MMD Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MMD