We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MLLT11 Recombinant Protein Antigen

Images

 
There are currently no images for MLLT11 Protein (NBP2-14237PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MLLT11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLLT11.

Source: E. coli

Amino Acid Sequence: FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MLLT11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14237.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLLT11 Recombinant Protein Antigen

  • AF1QRP11-316M1.10
  • ALL1 fused gene from chromosome 1q
  • ALL1-fused gene from chromosome 1q
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 11
  • protein AF1q

Background

The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-30472
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
H00000389-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
DMP900
Species: Hu
Applications: ELISA
NBP3-35145
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56080
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DGD150
Species: Hu
Applications: ELISA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-61814
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-14237PEP
Species: Hu
Applications: AC

Publications for MLLT11 Protein (NBP2-14237PEP) (0)

There are no publications for MLLT11 Protein (NBP2-14237PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLLT11 Protein (NBP2-14237PEP) (0)

There are no reviews for MLLT11 Protein (NBP2-14237PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLLT11 Protein (NBP2-14237PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLLT11 Products

Array NBP2-14237PEP

Research Areas for MLLT11 Protein (NBP2-14237PEP)

Find related products by research area.

Blogs on MLLT11

There are no specific blogs for MLLT11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLLT11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT11