Recombinant Human MLK3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MLK3 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 499 - 599 of Human MAP3K11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEPGQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSP

Protein/Peptide Type
Partial Recombinant Protein
Gene
MAP3K11

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MLK3 Protein

  • EC 2.7.11
  • EC 2.7.11.25
  • MAP3K11
  • MEKK11
  • mitogen-activated protein kinase kinase kinase 11
  • Mixed lineage kinase 3
  • MLK3
  • MLK3MLK-3
  • PTK1
  • PTK1protein-tyrosine kinase PTK1
  • RHOE
  • SH3 domain-containing proline-rich kinase
  • SPRK
  • SPRKMGC17114
  • Src-homology 3 domain-containing proline-rich kinase

Background

MAP3K11 - mitogen-activated protein kinase kinase kinase 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81272
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56928
Species: Hu
Applications: WB, ICC/IF
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37542
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46063
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for MLK3 Partial Recombinant Protein (H00004296-Q01) (0)

There are no publications for MLK3 Partial Recombinant Protein (H00004296-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLK3 Partial Recombinant Protein (H00004296-Q01) (0)

There are no reviews for MLK3 Partial Recombinant Protein (H00004296-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLK3 Partial Recombinant Protein (H00004296-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLK3 Products

Bioinformatics Tool for MLK3 Partial Recombinant Protein (H00004296-Q01)

Discover related pathways, diseases and genes to MLK3 Partial Recombinant Protein (H00004296-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLK3 Partial Recombinant Protein (H00004296-Q01)

Discover more about diseases related to MLK3 Partial Recombinant Protein (H00004296-Q01).
 

Pathways for MLK3 Partial Recombinant Protein (H00004296-Q01)

View related products by pathway.

PTMs for MLK3 Partial Recombinant Protein (H00004296-Q01)

Learn more about PTMs related to MLK3 Partial Recombinant Protein (H00004296-Q01).
 

Research Areas for MLK3 Partial Recombinant Protein (H00004296-Q01)

Find related products by research area.

Blogs on MLK3

There are no specific blogs for MLK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MLK3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K11
Entrez