MKRN3 Antibody (2E10) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: MKRN3 Antibody (2E10) [H00007681-M01] - Analysis of monoclonal antibody to MKRN3 on HeLa cell . Antibody concentration 10 ug/ml.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 2E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MKRN3 Antibody (2E10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MKRN3 (NP_005655, 437 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL
• Specificity: MKRN3 (2E10)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MKRN3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MKRN3 Antibody (2E10) - Azide and BSA Free

• EC 6.3.2.-
• makorin ring finger protein 3
• MGC88288
• RNF63D15S9
• ZFP127RING finger protein 63
• Zinc finger protein 127
• ZNF127probable E3 ubiquitin-protein ligase makorin-3

Background

The protein encoded by this gene contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs. This gene is intronless and imprinted, with expression only from the paternal allele. Disruption of the imprinting at this locus may contribute to Prader-Willi syndrome. An antisense RNA of unknown function has been found overlapping this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MKRN3
• Entrez:
  • 7681(Human)
• OMIM:
  • 603856(Human)
• Uniprot:
  • NP_005655(Human)