MKRN2 Antibody - BSA Free

Western Blot: MKRN2 Antibody [NBP1-83178] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-342

Immunocytochemistry/Immunofluorescence: MKRN2 Antibody [NBP1-83178] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: MKRN2 Antibody [NBP1-83178] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: MKRN2 Antibody [NBP1-83178] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Immunohistochemistry-Paraffin: MKRN2 Antibody [NBP1-83178] - Staining of human cerebral cortex, heart muscle, liver and testis using Anti-MKRN2 antibody NBP1-83178 (A) shows similar protein distribution across tissues to independent antibody NBP1-83179 (B).

Immunohistochemistry-Paraffin: MKRN2 Antibody [NBP1-83178] - Staining of human liver.

Immunohistochemistry-Paraffin: MKRN2 Antibody [NBP1-83178] - Staining of human testis.

Immunohistochemistry-Paraffin: MKRN2 Antibody [NBP1-83178] - Staining of human heart muscle.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MKRN2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MKRN2 Antibody - BSA Free (NBP1-83178) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESS
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MKRN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MKRN2 Protein (NBP1-83178PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MKRN2 Antibody - BSA Free

• EC 6.3.2.-
• HSPC070
• makorin ring finger protein 2
• probable E3 ubiquitin-protein ligase makorin-2
• RNF62RING finger protein 62

Background

Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MKRN2