MKLP1 Recombinant Protein Antigen

Images

 
There are currently no images for MKLP1 Recombinant Protein Antigen (NBP2-56923PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MKLP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MKLP1.

Source: E. coli

Amino Acid Sequence: APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF23
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56923.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MKLP1 Recombinant Protein Antigen

  • kinesin family member 23
  • kinesin-like 5 (mitotic kinesin-like protein 1)
  • Kinesin-like protein 5
  • kinesin-like protein KIF23
  • KNSL5CHO1
  • mitotic kinesin-like 1
  • MKLP-1
  • MKLP1Mitotic kinesin-like protein 1

Background

Using the CHO1 monoclonal antibody, Sellitto and Kuriyama (1988) identified a spindle antigen that was shown by Nislow et al. (1990) to be required for mitotic progression. By using the CHO1 antibody to screen a HeLa cell cDNA library, Nislow et al. (1992) isolated a KNSL5 cDNA, which they called MKLP1 (mitotic kinesin-like protein-1), that encodes this antigen. The N-terminal region of the deduced 961-amino acid protein contains a 350-residue domain that shares 30 to 45% identity with the motor domains of other members of the kinesin superfamily. The C-terminal region shows little identity with other kinesins. A central region contains heptad repeats of hydrophobic residues that may assemble into a coiled-coil structure similar to kinesin and myosin heavy chain proteins. The protein also contains a putative nuclear localization signal and 2 consensus phosphorylation sites characteristic of nuclear proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
H00029127-M01
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-87689
Species: Hu
Applications: IHC,  IHC-P, WB
H00009585-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-46483
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-82643
Species: Hu
Applications: WB
NBP1-83721
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-17874
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-56923PEP
Species: Hu
Applications: AC

Publications for MKLP1 Recombinant Protein Antigen (NBP2-56923PEP) (0)

There are no publications for MKLP1 Recombinant Protein Antigen (NBP2-56923PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKLP1 Recombinant Protein Antigen (NBP2-56923PEP) (0)

There are no reviews for MKLP1 Recombinant Protein Antigen (NBP2-56923PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MKLP1 Recombinant Protein Antigen (NBP2-56923PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MKLP1 Products

Array NBP2-56923PEP

Research Areas for MKLP1 Recombinant Protein Antigen (NBP2-56923PEP)

Find related products by research area.

Blogs on MKLP1

There are no specific blogs for MKLP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MKLP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF23