MKLP1 Antibody

Images

 
Western Blot: MKLP1 Antibody [NBP1-58141] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related MKLP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-58141
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MKLP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIF23(kinesin family member 23) The peptide sequence was selected from the middle region of KIF23. Peptide sequence KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQ.
Clonality
Polyclonal
Host
Rabbit
Gene
KIF23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KIF23 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MKLP1 Antibody

  • kinesin family member 23
  • kinesin-like 5 (mitotic kinesin-like protein 1)
  • Kinesin-like protein 5
  • kinesin-like protein KIF23
  • KNSL5CHO1
  • mitotic kinesin-like 1
  • MKLP-1
  • MKLP1Mitotic kinesin-like protein 1

Background

KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms. The protein encoded by this gene is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56651
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
H00029127-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-17052
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88042
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77939
Species: Hu, Mu, Rt, Ca, Ch, Pm, Ze
Applications: WB, ELISA
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
AF888
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-49233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83252
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58141
Species: Hu
Applications: WB

Publications for MKLP1 Antibody (NBP1-58141) (0)

There are no publications for MKLP1 Antibody (NBP1-58141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKLP1 Antibody (NBP1-58141) (0)

There are no reviews for MKLP1 Antibody (NBP1-58141). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MKLP1 Antibody (NBP1-58141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKLP1 Antibody Products

MKLP1 NBP1-58141

Related Products by Gene

Bioinformatics Tool for MKLP1 Antibody (NBP1-58141)

Discover related pathways, diseases and genes to MKLP1 Antibody (NBP1-58141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKLP1 Antibody (NBP1-58141)

Discover more about diseases related to MKLP1 Antibody (NBP1-58141).
 

Pathways for MKLP1 Antibody (NBP1-58141)

View related products by pathway.

PTMs for MKLP1 Antibody (NBP1-58141)

Learn more about PTMs related to MKLP1 Antibody (NBP1-58141).
 

Research Areas for MKLP1 Antibody (NBP1-58141)

Find related products by research area.

Blogs on MKLP1

There are no specific blogs for MKLP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol KIF23
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-58141 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.