MiRP3 Antibody (1D7)

Images

 
Sandwich ELISA: MiRP3 Antibody (1D7) [H00023704-M01] - Detection limit for recombinant GST tagged KCNE4 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MiRP3 Antibody (1D7) Summary

Immunogen
KCNE4 (AAH14429, 1 a.a. ~ 171 a.a) full length recombinant protein with GST tag.MLKMEPLNSTHPGTAASSSPLESRAAGGGSGNGNEYFYILVV MSFYGIFLIGIMLGYMKSKRREKKSSLLLLYKDEERLWGEAM KPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVS SESSSPDVHLTIQEEGADEELEETSETPLNESSEGSSENIHQ NS
Specificity
KCNE4 - potassium voltage-gated channel, Isk-related family, member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNE4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MiRP3 Antibody (1D7)

  • cardiac voltage-gated potassium channel accessory subunit 4
  • MGC20353
  • Minimum potassium ion channel-related peptide 3
  • MinK-related peptide 3
  • MiRP3
  • Potassium channel subunit beta MiRP3
  • potassium voltage-gated channel subfamily E member 4
  • potassium voltage-gated channel, Isk-related family, member 4

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a type I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate the gating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the embryo and in adult uterus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-83238
Species: Hu
Applications: IHC, IHC-P
NBP1-85835
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBL1-12154
Species: Hu
NBP2-19315
Species: Hu
Applications: WB
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBL1-12155
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003736-B01P
Species: Hu
Applications: WB
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP

Publications for MiRP3 Antibody (H00023704-M01) (0)

There are no publications for MiRP3 Antibody (H00023704-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP3 Antibody (H00023704-M01) (0)

There are no reviews for MiRP3 Antibody (H00023704-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MiRP3 Antibody (H00023704-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MiRP3 Products

Bioinformatics Tool for MiRP3 Antibody (H00023704-M01)

Discover related pathways, diseases and genes to MiRP3 Antibody (H00023704-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MiRP3 Antibody (H00023704-M01)

Discover more about diseases related to MiRP3 Antibody (H00023704-M01).
 

Pathways for MiRP3 Antibody (H00023704-M01)

View related products by pathway.

PTMs for MiRP3 Antibody (H00023704-M01)

Learn more about PTMs related to MiRP3 Antibody (H00023704-M01).

Blogs on MiRP3

There are no specific blogs for MiRP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MiRP3 Antibody (1D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE4
Entrez
OMIM
Uniprot