MIR16 Antibody (2H6)

Images

 
Immunocytochemistry/ Immunofluorescence: MIR16 Antibody (2H6) [H00051573-M04] - Analysis of monoclonal antibody to GDE1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MIR16 Antibody (2H6) Summary

Immunogen
MIR16 (NP_057725, 31 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLN
Specificity
MIR16 - membrane interacting protein of RGS16
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GDE1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MIR16 Antibody (2H6)

  • EC 3.1.4.44
  • glycerophosphodiester phosphodiesterase 1
  • membrane interacting protein of RGS16
  • Membrane-interacting protein of RGS16
  • MIR16363E6.2
  • RGS16-interacting membrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
H00002166-M07
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-83711
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-71691
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
640-A3
Species: Mu
Applications: Bind
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-80070
Species: Fu, Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-88908
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41268
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-45564
Species: Hu
Applications: ICC/IF, IF, IHC-P, WB
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00051573-M04
Species: Hu
Applications: ELISA, ICC/IF

Publications for MIR16 Antibody (H00051573-M04) (0)

There are no publications for MIR16 Antibody (H00051573-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIR16 Antibody (H00051573-M04) (0)

There are no reviews for MIR16 Antibody (H00051573-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MIR16 Antibody (H00051573-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MIR16 Products

Bioinformatics Tool for MIR16 Antibody (H00051573-M04)

Discover related pathways, diseases and genes to MIR16 Antibody (H00051573-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIR16 Antibody (H00051573-M04)

Discover more about diseases related to MIR16 Antibody (H00051573-M04).
 

Pathways for MIR16 Antibody (H00051573-M04)

View related products by pathway.

Blogs on MIR16

There are no specific blogs for MIR16, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIR16 Antibody (2H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol GDE1
Entrez
OMIM
Uniprot