Mind Bomb 2/MIB2 Antibody (3A7) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Mind Bomb 2/MIB2 Antibody (3A7) - Azide and BSA Free (H00142678-M02) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
MIB2 (AAH37542, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL |
| Specificity |
MIB2 - mindbomb homolog 2 (Drosophila) (3A7) |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MIB2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product is useful for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Mind Bomb 2/MIB2 Antibody (3A7) - Azide and BSA Free
Background
MIB2/Skeletrophin is an actin-binding protein that bears two MIB/HERC2 domains, a ZZ-type zinc-finger domain, nine ankyrin repeats, and two RING-finger domains. The C-terminal RING domain has been found to have E3 ubiquitin ligase activity that mediates ubiquitination of the intracellular regions of the Notch receptor and its ligands to regulate Notch signaling. MIB2/Skeletrophin appears to be important to muscle development and may function as a suppressor of melanoma invasion.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Pm
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Publications for Mind Bomb 2/MIB2 Antibody (H00142678-M02) (0)
There are no publications for Mind Bomb 2/MIB2 Antibody (H00142678-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mind Bomb 2/MIB2 Antibody (H00142678-M02) (0)
There are no reviews for Mind Bomb 2/MIB2 Antibody (H00142678-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Mind Bomb 2/MIB2 Antibody (H00142678-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Mind Bomb 2/MIB2 Products
Research Areas for Mind Bomb 2/MIB2 Antibody (H00142678-M02)
Find related products by research area.
|
Blogs on Mind Bomb 2/MIB2