Recombinant Human MIF4GD GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MIF4GD GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-256 of Human MIF4GD full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
MIF4GD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
55.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MIF4GD GST (N-Term) Protein

  • AD023
  • hSLIP1
  • MGC45027
  • MIF4G domain containing
  • MIFD
  • SLBP (stem loop binding protein)-interacting protein 1
  • SLBP-interacting protein 1
  • SLIP1MIF4G domain-containing protein

Background

This gene encodes a protein which contains an MIF4G domain. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007884-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-87947
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84869
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31647
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP1-82917
Species: Hu
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-85302
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DCRP00
Species: Hu
Applications: ELISA
NBP2-17058
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-87781
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90454
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00057409-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MIF4GD Recombinant Protein (H00057409-P01) (0)

There are no publications for MIF4GD Recombinant Protein (H00057409-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIF4GD Recombinant Protein (H00057409-P01) (0)

There are no reviews for MIF4GD Recombinant Protein (H00057409-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MIF4GD Recombinant Protein (H00057409-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MIF4GD Products

Bioinformatics Tool for MIF4GD Recombinant Protein (H00057409-P01)

Discover related pathways, diseases and genes to MIF4GD Recombinant Protein (H00057409-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIF4GD Recombinant Protein (H00057409-P01)

Discover more about diseases related to MIF4GD Recombinant Protein (H00057409-P01).
 

Pathways for MIF4GD Recombinant Protein (H00057409-P01)

View related products by pathway.

PTMs for MIF4GD Recombinant Protein (H00057409-P01)

Learn more about PTMs related to MIF4GD Recombinant Protein (H00057409-P01).

Blogs on MIF4GD

There are no specific blogs for MIF4GD, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MIF4GD GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MIF4GD