MIDN Antibody

Images

 
Western Blot: MIDN Antibody [NBP2-30437] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line NTERA-2
Immunocytochemistry/ Immunofluorescence: MIDN Antibody [NBP2-30437] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry: MIDN Antibody [NBP2-30437] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MIDN Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIDN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MIDN Protein (NBP2-30437PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MIDN Antibody

  • DKFZp547M072
  • Midbrain nucleolar protein
  • midnolin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP1-52067
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF603
Species: Mu
Applications: WB, Block, ICC
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
H00001297-T01
Species: Hu
NBP2-47534
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14513
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83638
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP1-81252
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MIDN Antibody (NBP2-30437) (0)

There are no publications for MIDN Antibody (NBP2-30437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIDN Antibody (NBP2-30437) (0)

There are no reviews for MIDN Antibody (NBP2-30437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MIDN Antibody (NBP2-30437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MIDN Products

Bioinformatics Tool for MIDN Antibody (NBP2-30437)

Discover related pathways, diseases and genes to MIDN Antibody (NBP2-30437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIDN Antibody (NBP2-30437)

Discover more about diseases related to MIDN Antibody (NBP2-30437).
 

Pathways for MIDN Antibody (NBP2-30437)

View related products by pathway.

Blogs on MIDN

There are no specific blogs for MIDN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIDN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIDN
Uniprot