MGST2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGST2. Source: E. coli
Amino Acid Sequence: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MGST2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82653. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MGST2 Recombinant Protein Antigen
Background
Characterized as important mediators of inflammation, MGST2 (microsomal glutathione S-transferase 2) is an important regulator of leukotriene and glutathione. MGST2 belongs to the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family of six human proteins. Several of these proteins are involved in the creation of leukotrienes and prostaglandin E. MGST2 catalyzes the production of LTC4 from LTA4 and reduced glutathione, and also catalyzes the conjugation of 1-chloro-2, 4-dinitrobenzene with reduced glutathione. Diseases associated with this gene include psoriasis, asthma, leukemia, prostatitis, breast cancer and progressive familial intrahepatic cholestasis type 1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: DirELISA, IP, WB
Publications for MGST2 Protein (NBP1-82653PEP) (0)
There are no publications for MGST2 Protein (NBP1-82653PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MGST2 Protein (NBP1-82653PEP) (0)
There are no reviews for MGST2 Protein (NBP1-82653PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MGST2 Protein (NBP1-82653PEP) (0)
Additional MGST2 Products
Blogs on MGST2