We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MGAT4B Recombinant Protein Antigen

Images

 
There are currently no images for MGAT4B Protein (NBP2-14236PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MGAT4B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGAT4B.

Source: E. coli

Amino Acid Sequence: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MGAT4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14236.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MGAT4B Recombinant Protein Antigen

  • alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
  • alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
  • aminyltransferase
  • EC 2.4.1.145
  • GlcNAc-T IVb
  • GNT-IV
  • GNT-IVB
  • isoenzyme B
  • isozyme B
  • mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
  • N-acetylglucosaminyltransferase IVb
  • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb
  • UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IV
  • UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IVb

Background

MGAT4B, also known as Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, has 3 isoforms, a 548 amino acid isoform that is 63 kDa, a 547 amino acid isoform that is 63 kDa, and a 563 amino acid isoform that is 65 kDa; participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans; acts as a catalyzer in the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans; necessary for the production of tri- and tetra-antennary N-linked sugar chains, and it is not the main contributor in N-glycan biosynthesis. Disease research is currently being performed with relation to MGAT4B and immunodeficiency, pancreatic cancer, hepatocellular carcinoma, pancreatitis, interferon, carcinoma, and extrahepatic bile duct carcinoma. Interactions with this protein have been shown to involve LRSAM1, MGAT2, MGAT3, MGAT5, FUT8, and MGAT5B in N-glycan antennae elongation in the medial/trans-Golgi, transport to the Golgi and subsequent modification, asparagine N-linked glycosylation, N-Glycan antennae elongation, methabolism of proteins, N-Glycan biosynthesis, and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81809
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
DPG00
Species: Hu
Applications: ELISA
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB5469
Species: Hu
Applications: ICC, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP2-15311
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for MGAT4B Protein (NBP2-14236PEP) (0)

There are no publications for MGAT4B Protein (NBP2-14236PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGAT4B Protein (NBP2-14236PEP) (0)

There are no reviews for MGAT4B Protein (NBP2-14236PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MGAT4B Protein (NBP2-14236PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MGAT4B Products

Research Areas for MGAT4B Protein (NBP2-14236PEP)

Find related products by research area.

Blogs on MGAT4B

There are no specific blogs for MGAT4B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MGAT4B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MGAT4B