MFSD6 Antibody - BSA Free

Western Blot: MFSD6 Antibody [NBP2-85276] - Host: Rabbit. Target Name: MFSD6. Sample Tissue: Human MCF7 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MFSD6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MFSD6 Antibody - BSA Free (NBP2-85276) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human MFSD6. Peptide sequence: ADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MFSD6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MFSD6 Antibody - BSA Free

• hMMR2
• Macrophage MHC class I receptor 2 homolog
• macrophage MHC receptor 2
• major facilitator superfamily domain containing 6
• major facilitator superfamily domain-containing protein 6
• MMR2FLJ20160

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MFSD6