ATP9B Antibody

Images

 
Immunohistochemistry: ATP9B Antibody [NBP1-88906] - Staining of human placenta shows strong cytoplasmic positivity in decidua cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP9B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP9B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP9B Protein (NBP1-88906PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP9B Antibody

  • ATPase, class II, type 9B
  • ATPIIB
  • DKFZp686H2093
  • MGC150650
  • MGC150651
  • phospholipid transporting (P-type)
  • probable phospholipid-transporting ATPase IIB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82203
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77189
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-90840
Species: Hu
Applications: IHC, IHC-P
NBP1-88902
Species: Hu
Applications: IHC, IHC-P
NBP1-88905
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
NBP2-14327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-77190
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NLS4229
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-88906
Species: Hu
Applications: IHC, IHC-P

Publications for ATP9B Antibody (NBP1-88906) (0)

There are no publications for ATP9B Antibody (NBP1-88906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP9B Antibody (NBP1-88906) (0)

There are no reviews for ATP9B Antibody (NBP1-88906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP9B Antibody (NBP1-88906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP9B Products

Bioinformatics Tool for ATP9B Antibody (NBP1-88906)

Discover related pathways, diseases and genes to ATP9B Antibody (NBP1-88906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ATP9B Antibody (NBP1-88906)

View related products by pathway.

Blogs on ATP9B

There are no specific blogs for ATP9B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP9B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP9B